PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G078000.4
Common NameB456_003G078000, LOC105788203
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARF
Protein Properties Length: 692aa    MW: 77333.5 Da    PI: 6.7494
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G078000.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.12e-24131231198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+kvlt sd++++g +++ +k+a+e+     +++ + +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +
  Gorai.003G078000.4 131 FCKVLTASDTSTHGGFSVLRKHATEClppldMNQATPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--R 219
                         99****************************9555556679************************************************..4 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Gorai.003G078000.4 220 GESGELRVGVRR 231
                         49999*****98 PP

2Auxin_resp105.75.3e-35257336183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st++ F v+Y+Pr+  s+F++ ++k+++al++k++vGmRfkm+fe+eds+err+sGt+vgv+d++p  W++SkWrsLk
  Gorai.003G078000.4 257 ASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPERRFSGTIVGVEDFSP-YWKDSKWRSLK 336
                         789***************6..9*************************************************.9********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.79E-40122260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.7E-40124246IPR015300DNA-binding pseudobarrel domain
CDDcd100171.53E-20130231No hitNo description
PfamPF023621.8E-22131231IPR003340B3 DNA binding domain
SMARTSM010191.8E-23131233IPR003340B3 DNA binding domain
PROSITE profilePS5086312.266131233IPR003340B3 DNA binding domain
PfamPF065071.4E-32257336IPR010525Auxin response factor
PfamPF023093.6E-13543663IPR033389AUX/IAA domain
SuperFamilySSF542771.77E-15571654No hitNo description
PROSITE profilePS5174528.257578659IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.9E-4601652No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MANRGGVFSQ TNNVSSEVKG NGGDDLYMEL WKLCAGPLVE APRARERVYY FPQGHMEQLE  60
ASTNQELNQR IPLFNLPSKI LCSVVHIQFL AEQETDEVYA QITLMPEPNQ PEPTTPDACP  120
PEPPKPTVCS FCKVLTASDT STHGGFSVLR KHATECLPPL DMNQATPTQE LVAKDLHGYE  180
WRFKHIFRGQ PRRHLLTTGW STFVTSKRLV AGDSFVFLRG ESGELRVGVR RVARQQSSMP  240
TSVISSQSMH LGVLATASHA VSTQTLFVVY YKPRTSQFII GLNKYLEALN NKFTVGMRFK  300
MRFEGEDSPE RRFSGTIVGV EDFSPYWKDS KWRSLKVQWD EPASIPRPDR VSPWEIEPFA  360
APIPPTLGQP VAAKNKRPRP TAEIPALASA PWNSGVMHTH DLMRRNITAE ANRNENHVIW  420
HMQTEMSSSC SSVLKTQNEG SWLSSPCMSV SKHRFPDARD DSKCASGWPV LSGLSNPQVN  480
NDSTFDPIEK VKKSETASSC RLFGIELINH SASSRQLERT PTQLSTMTAS TAEGHHTLSP  540
NNSCQKSEIS KDSNEKQEQL QLQAKEIQSR QSCPSSTRSR TKVQMQGVAV GRAVDLAMLE  600
GYDQLIDELE EMFDIKGELR PRNKWEIVYT DDEGDMMLVG DDPWQEFCSM VRRIFICLSQ  660
DVKKLSTGSK LPMACIEGGE GTVISSESIE N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17683591355Auxin response factor 1
4ldw_A1e-17683591355Auxin response factor 1
4ldw_B1e-17683591355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1375379KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5850153e-54JX585015.1 Gossypium hirsutum clone NBRI_GE18462 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470430.10.0PREDICTED: auxin response factor 9 isoform X3
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A0D2QPW10.0A0A0D2QPW1_G
STRINGVIT_02s0025g01740.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]